PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Kalax.0129s0023.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Saxifragales; Crassulaceae; Kalanchoe
Family G2-like
Protein Properties Length: 466aa    MW: 50932.2 Da    PI: 7.7414
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Kalax.0129s0023.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like79.44.4e-25189243156
              G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
                          k +++W pe+H++Fv+aveqL G +kA+P++ile+m+ ++Lt+++++SHLQkYR++
  Kalax.0129s0023.1.p 189 KVKVDWKPEMHRQFVQAVEQL-GVDKAVPSRILEIMGNDCLTRHNIASHLQKYRSH 243
                          5689*****************.********************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129414.323186245IPR017930Myb domain
Gene3DG3DSA:1.10.10.605.3E-24187246IPR009057Homeodomain-like
SuperFamilySSF466891.79E-15188246IPR009057Homeodomain-like
TIGRFAMsTIGR015578.4E-24189243IPR006447Myb domain, plants
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0007165Biological Processsignal transduction
GO:0009658Biological Processchloroplast organization
GO:0009910Biological Processnegative regulation of flower development
GO:0010380Biological Processregulation of chlorophyll biosynthetic process
GO:0010638Biological Processpositive regulation of organelle organization
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:1900056Biological Processnegative regulation of leaf senescence
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 466 aa     Download sequence    Send to blast
MLAVVSQLGN LNDGHEGSTS KQQTAQLEAF TIIGDVEFPD SSSGNLLESI DFDDLFNDSE  60
ALPDLEMDPD ILAEFSLSSG EEYCSDLNTT SVKKTAADSD GQTLGINSGI GLGLVPGSST  120
SSITWQDDHE IESNRNPDLA AVTTNEKLLS KKCVNYNRPA KATYKSNNKP SGVSSKGASK  180
KGSLVGNRKV KVDWKPEMHR QFVQAVEQLG VDKAVPSRIL EIMGNDCLTR HNIASHLQKY  240
RSHRKHLLAR KAEAAGWSQW RHAYASGATA TRAVLGKRDQ GSPWVVPIQT IRYPPVTSPT  300
KQHKSIQAPG HHMRPLHVWG HPPVDQSLRP LWPKHSPTYT IQPSPTYPMP QQDSSPYWHN  360
SQTRPQRSIQ SGLCQRKPCF SPPLGTARFP AQVEAGEVGA PTRQFGSQPY LNFHPSEESL  420
DAAIGDVLSK PWLPLPIGLK PPELDSVMGE LQRNGIPNIP PHGLN*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00022PBMTransfer from AT2G20570Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006446694.11e-113hypothetical protein CICLE_v10015266mg
TrEMBLA0A067EF821e-115A0A067EF82_CITSI; Uncharacterized protein
STRINGGLYMA12G33430.11e-111(Glycine max)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G20570.12e-70GBF's pro-rich region-interacting factor 1